SCOPe 2.01: Domain d2pzwa_: 2pzw A:

Lineage for d2pzwa_ (2pzw A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family)

5. Family b.40.1.1: Staphylococcal nuclease [50200] (2 proteins)
   barrel, closed; n=5, S=10

6. Protein Staphylococcal nuclease [50201] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50202] (147 PDB entries)
   Uniprot P00644 89-223

8. Domain d2pzwa_: 2pzw A: [167370]
   automated match to d1joka_

Details for d2pzwa_

PDB Entry: 2pzw, 2.1 Å

PDB Description: crystal structure of staphylococcal nuclease variant v66n/p117g/h124l/s128a at room temperature

PDB Compounds: (A:) Thermonuclease

SCOPe Domain Sequences for d2pzwa_:

Sequence, based on SEQRES records:

>d2pzwa_ b.40.1.1 (A:) Staphylococcal nuclease {Staphylococcus aureus [TaxId: 1280]}
lhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkmn
enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllr
kaeaqakkeklniws

Sequence, based on observed residues (ATOM records):

>d2pzwa_ b.40.1.1 (A:) Staphylococcal nuclease {Staphylococcus aureus [TaxId: 1280]}
lhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkvekygpeasaftkkmnenakk
ievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllrkaeaq
akkeklniws

Timeline for d2pzwa_:

• d2pzwa_ is new in SCOPe 2.01-stable
  
• d2pzwa_ appears in SCOPe 2.02
  
• d2pzwa_ appears in the current release, SCOPe 2.08