![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein Dodecameric ferritin homolog [47250] (16 species) |
![]() | Species Listeria innocua [TaxId:1642] [47252] (7 PDB entries) |
![]() | Domain d1qghj_: 1qgh J: [16737] complexed with fe |
PDB Entry: 1qgh (more details), 2.35 Å
SCOPe Domain Sequences for d1qghj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qghj_ a.25.1.1 (J:) Dodecameric ferritin homolog {Listeria innocua [TaxId: 1642]} vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd vtndmliafkasidkhiwmfkaflgkaple
Timeline for d1qghj_: