Lineage for d2pzvd_ (2pzv D:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2504826Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2505360Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2505452Family d.17.4.3: Ketosteroid isomerase-like [54434] (3 proteins)
    automatically mapped to Pfam PF12680
    automatically mapped to Pfam PF02136
  6. 2505453Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (2 species)
  7. 2505526Species Pseudomonas putida [TaxId:303] [54437] (53 PDB entries)
    Uniprot P07445
  8. 2505532Domain d2pzvd_: 2pzv D: [167369]
    automated match to d1e3vb_
    complexed with iph

Details for d2pzvd_

PDB Entry: 2pzv (more details), 1.25 Å

PDB Description: Crystal Structure of Ketosteroid Isomerase D40N from Pseudomonas Putida (pksi) with bound Phenol
PDB Compounds: (D:) steroid delta-isomerase

SCOPe Domain Sequences for d2pzvd_:

Sequence, based on SEQRES records: (download)

>d2pzvd_ d.17.4.3 (D:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]}
nlptaqevqglmaryielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqgl
gggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqayws
evnlsv

Sequence, based on observed residues (ATOM records): (download)

>d2pzvd_ d.17.4.3 (D:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]}
nlptaqevqglmaryielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqgl
kvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqaywsevn
lsv

SCOPe Domain Coordinates for d2pzvd_:

Click to download the PDB-style file with coordinates for d2pzvd_.
(The format of our PDB-style files is described here.)

Timeline for d2pzvd_: