Lineage for d2pzbd1 (2pzb D:1-272)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2118897Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2119957Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2119958Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins)
  6. 2120044Protein NH3-dependent NAD+-synthetase [52406] (4 species)
  7. 2120045Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188002] (3 PDB entries)
  8. 2120049Domain d2pzbd1: 2pzb D:1-272 [167363]
    Other proteins in same PDB: d2pzba2, d2pzbb2, d2pzbc2, d2pzbd2
    automated match to d1ee1a_
    complexed with so4

Details for d2pzbd1

PDB Entry: 2pzb (more details), 1.9 Å

PDB Description: nad+ synthetase from bacillus anthracis
PDB Compounds: (D:) nh(3)-dependent nad(+) synthetase

SCOPe Domain Sequences for d2pzbd1:

Sequence, based on SEQRES records: (download)

>d2pzbd1 c.26.2.1 (D:1-272) NH3-dependent NAD+-synthetase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mtlqeqimkalhvqpvidpkaeirkrvdflkdyvkktgakgfvlgisggqdstlagrlaq
laveeirneggnatfiavrlpykvqkdeddaqlalqfiqadqsvafdiastvdafsnqye
nlldesltdfnkgnvkarirmvtqyaiggqkgllvigtdhaaeavtgfftkfgdggadll
pltgltkrqgrallqelgaderlylkmptadlldekpgqadetelgitydqlddylegkt
vpadvaekiekrytvsehkrqvpasmfddwwk

Sequence, based on observed residues (ATOM records): (download)

>d2pzbd1 c.26.2.1 (D:1-272) NH3-dependent NAD+-synthetase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mtlqeqimkalhvqpvidpkaeirkrvdflkdyvkktgakgfvlgisggqdstlagrlaq
laveeirneggnatfiavrlpykvddaqlalqfiqadqsvafdiastvdafsnqyenlld
esltdfnkgnvkarirmvtqyaiggqkgllvigtdhaaeavtgfftkfgdggadllpltg
ltkrqgrallqelgaderlylitydqlddylegktvpadvaekiekrytvsasmfddwwk

SCOPe Domain Coordinates for d2pzbd1:

Click to download the PDB-style file with coordinates for d2pzbd1.
(The format of our PDB-style files is described here.)

Timeline for d2pzbd1: