Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins) |
Protein NH3-dependent NAD+-synthetase [52406] (4 species) |
Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188002] (3 PDB entries) |
Domain d2pzbd1: 2pzb D:1-272 [167363] Other proteins in same PDB: d2pzba2, d2pzbb2, d2pzbc2, d2pzbd2 automated match to d1ee1a_ complexed with so4 |
PDB Entry: 2pzb (more details), 1.9 Å
SCOPe Domain Sequences for d2pzbd1:
Sequence, based on SEQRES records: (download)
>d2pzbd1 c.26.2.1 (D:1-272) NH3-dependent NAD+-synthetase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} mtlqeqimkalhvqpvidpkaeirkrvdflkdyvkktgakgfvlgisggqdstlagrlaq laveeirneggnatfiavrlpykvqkdeddaqlalqfiqadqsvafdiastvdafsnqye nlldesltdfnkgnvkarirmvtqyaiggqkgllvigtdhaaeavtgfftkfgdggadll pltgltkrqgrallqelgaderlylkmptadlldekpgqadetelgitydqlddylegkt vpadvaekiekrytvsehkrqvpasmfddwwk
>d2pzbd1 c.26.2.1 (D:1-272) NH3-dependent NAD+-synthetase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} mtlqeqimkalhvqpvidpkaeirkrvdflkdyvkktgakgfvlgisggqdstlagrlaq laveeirneggnatfiavrlpykvddaqlalqfiqadqsvafdiastvdafsnqyenlld esltdfnkgnvkarirmvtqyaiggqkgllvigtdhaaeavtgfftkfgdggadllpltg ltkrqgrallqelgaderlylitydqlddylegktvpadvaekiekrytvsasmfddwwk
Timeline for d2pzbd1: