SCOPe 2.08: Domain d2pzbc1: 2pzb C:2-272

Lineage for d2pzbc1 (2pzb C:2-272)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins)

6. Protein NH3-dependent NAD+-synthetase [52406] (4 species)

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188002] (3 PDB entries)

8. Domain d2pzbc1: 2pzb C:2-272 [167362]
   Other proteins in same PDB: d2pzba2, d2pzbb2, d2pzbc2, d2pzbd2
   automated match to d1ee1a_
   complexed with so4
   has additional insertions and/or extensions that are not grouped together

Details for d2pzbc1

PDB Entry: 2pzb, 1.9 Å

PDB Description: nad+ synthetase from bacillus anthracis

PDB Compounds: (C:) nh(3)-dependent nad(+) synthetase

SCOPe Domain Sequences for d2pzbc1:

Sequence, based on SEQRES records:

>d2pzbc1 c.26.2.1 (C:2-272) NH3-dependent NAD+-synthetase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
tlqeqimkalhvqpvidpkaeirkrvdflkdyvkktgakgfvlgisggqdstlagrlaql
aveeirneggnatfiavrlpykvqkdeddaqlalqfiqadqsvafdiastvdafsnqyen
lldesltdfnkgnvkarirmvtqyaiggqkgllvigtdhaaeavtgfftkfgdggadllp
ltgltkrqgrallqelgaderlylkmptadlldekpgqadetelgitydqlddylegktv
padvaekiekrytvsehkrqvpasmfddwwk

Sequence, based on observed residues (ATOM records):

>d2pzbc1 c.26.2.1 (C:2-272) NH3-dependent NAD+-synthetase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
tlqeqimkalhvqpvidpkaeirkrvdflkdyvkktgakgfvlgisggqdstlagrlaql
aveeirneggnatfiavrlpykddaqlalqfiqadqsvafdiastvdafsnqyenlldes
ltdfnkgnvkarirmvtqyaiggqkgllvigtdhaaeavtgfftkfgdggadllpltglt
krqgrallqelgaderlylitydqlddylegktvpadvaekiekrytvsmfddwwk

Timeline for d2pzbc1:

• d2pzbc1 first appeared in SCOPe 2.01, called d2pzbc_
  
• d2pzbc1 appears in SCOPe 2.07