| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) ![]() share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
| Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins) |
| Protein NH3-dependent NAD+-synthetase [52406] (4 species) |
| Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188002] (3 PDB entries) |
| Domain d2pz8b_: 2pz8 B: [167357] automated match to d1ee1a_ complexed with apc, gol, mg |
PDB Entry: 2pz8 (more details), 2 Å
SCOPe Domain Sequences for d2pz8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pz8b_ c.26.2.1 (B:) NH3-dependent NAD+-synthetase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mtlqeqimkalhvqpvidpkaeirkrvdflkdyvkktgakgfvlgisggqdstlagrlaq
laveeirneggnatfiavrlpykvqkdeddaqlalqfiqadqsvafdiastvdafsnqye
nlldesltdfnkgnvkarirmvtqyaiggqkgllvigtdhaaeavtgfftkfgdggadll
pltgltkrqgrallqelgaderlylkmptadlldekpgqadetelgitydqlddylegkt
vpadvaekiekrytvsehkrqvpasmfddwwklaaalehh
Timeline for d2pz8b_: