SCOPe 2.04: Domain d2pz8b_: 2pz8 B:

Lineage for d2pz8b_ (2pz8 B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins)

6. Protein NH3-dependent NAD+-synthetase [52406] (4 species)

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188002] (3 PDB entries)

8. Domain d2pz8b_: 2pz8 B: [167357]
   automated match to d1ee1a_
   complexed with apc, gol, mg

Details for d2pz8b_

PDB Entry: 2pz8, 2 Å

PDB Description: NAD+ Synthetase from Bacillus anthracis with AMP-CPP and Mg2+

PDB Compounds: (B:) nh(3)-dependent nad(+) synthetase

SCOPe Domain Sequences for d2pz8b_:

Sequence; same for both SEQRES and ATOM records:

>d2pz8b_ c.26.2.1 (B:) NH3-dependent NAD+-synthetase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mtlqeqimkalhvqpvidpkaeirkrvdflkdyvkktgakgfvlgisggqdstlagrlaq
laveeirneggnatfiavrlpykvqkdeddaqlalqfiqadqsvafdiastvdafsnqye
nlldesltdfnkgnvkarirmvtqyaiggqkgllvigtdhaaeavtgfftkfgdggadll
pltgltkrqgrallqelgaderlylkmptadlldekpgqadetelgitydqlddylegkt
vpadvaekiekrytvsehkrqvpasmfddwwklaaalehh

Timeline for d2pz8b_:

• d2pz8b_ first appeared in SCOPe 2.01
  
• d2pz8b_ appears in SCOPe 2.03
  
• d2pz8b_ appears in SCOPe 2.05
  
• d2pz8b_ appears in the current release, SCOPe 2.08, called d2pz8b1