Lineage for d2pz8b_ (2pz8 B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1359291Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1360010Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 1360011Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins)
  6. 1360088Protein NH3-dependent NAD+-synthetase [52406] (4 species)
  7. 1360089Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188002] (3 PDB entries)
  8. 1360095Domain d2pz8b_: 2pz8 B: [167357]
    automated match to d1ee1a_
    complexed with apc, gol, mg

Details for d2pz8b_

PDB Entry: 2pz8 (more details), 2 Å

PDB Description: NAD+ Synthetase from Bacillus anthracis with AMP-CPP and Mg2+
PDB Compounds: (B:) nh(3)-dependent nad(+) synthetase

SCOPe Domain Sequences for d2pz8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pz8b_ c.26.2.1 (B:) NH3-dependent NAD+-synthetase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mtlqeqimkalhvqpvidpkaeirkrvdflkdyvkktgakgfvlgisggqdstlagrlaq
laveeirneggnatfiavrlpykvqkdeddaqlalqfiqadqsvafdiastvdafsnqye
nlldesltdfnkgnvkarirmvtqyaiggqkgllvigtdhaaeavtgfftkfgdggadll
pltgltkrqgrallqelgaderlylkmptadlldekpgqadetelgitydqlddylegkt
vpadvaekiekrytvsehkrqvpasmfddwwklaaalehh

SCOPe Domain Coordinates for d2pz8b_:

Click to download the PDB-style file with coordinates for d2pz8b_.
(The format of our PDB-style files is described here.)

Timeline for d2pz8b_: