SCOPe 2.06: Domain d2pyya_: 2pyy A:

Lineage for d2pyya_ (2pyy A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (140 species)
   not a true protein

7. Species Nostoc punctiforme [TaxId:63737] [188325] (1 PDB entry)

8. Domain d2pyya_: 2pyy A: [167351]
   automated match to d1ggga_
   complexed with glu

Details for d2pyya_

PDB Entry: 2pyy, 2.1 Å

PDB Description: Crystal Structure of the GluR0 ligand-binding core from Nostoc punctiforme in complex with (L)-glutamate

PDB Compounds: (A:) Ionotropic glutamate receptor bacterial homologue

SCOPe Domain Sequences for d2pyya_:

Sequence, based on SEQRES records:

>d2pyya_ c.94.1.0 (A:) automated matches {Nostoc punctiforme [TaxId: 63737]}
pllvatrvippfvlsnkgelsgfsidlwrsiatqigiesklieyssvpelisaikdnkvn
lgiaaisitaereqnfdfslpifasglqimvrnlesgtgdirsiddlpgkvvattagsta
atylrehhisvlevpkieeaykalqtkkadavvfdapvllfyaanegkgkveivgsilre
esygiilpnnspyrkpinqallnlkengtyqslydkwfdp

Sequence, based on observed residues (ATOM records):

>d2pyya_ c.94.1.0 (A:) automated matches {Nostoc punctiforme [TaxId: 63737]}
pllvatrvippfvlsnlsgfsidlwrsiatqigiesklieyssvpelisaikdnkvnlgi
aaisitaereqnfdfslpifasglqimvrngdirsiddlpgkvvattagstaatylrehh
isvlevpkieeaykalqtkkadavvfdapvllfyaanegkgkveivgsilreesygiilp
nnspyrkpinqallnlkengtyqslydkwfdp

Timeline for d2pyya_:

• d2pyya_ first appeared in SCOPe 2.01
  
• d2pyya_ appears in SCOPe 2.05
  
• d2pyya_ appears in SCOPe 2.07
  
• d2pyya_ appears in the current release, SCOPe 2.08