SCOPe 2.06: Domain d2pywa_: 2pyw A:

Lineage for d2pywa_ (2pyw A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (25 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188319] (25 PDB entries)

8. Domain d2pywa_: 2pyw A: [167349]
   automated match to d2puia1
   complexed with adp, cl, edo, mg, sr1

Details for d2pywa_

PDB Entry: 2pyw, 1.9 Å

PDB Description: structure of a. thaliana 5-methylthioribose kinase in complex with adp and mtr

PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d2pywa_:

Sequence; same for both SEQRES and ATOM records:

>d2pywa_ d.144.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
feeftplnekslvdyikstpalsskigadksdddlvikevgdgnlnfvfivvgssgslvi
kqalpyircigeswpmtkerayfeattlrkhgnlspdhvpevyhfdrtmaligmrylepp
hiilrkgliagieypfladhmsdymaktlfftsllyhdttehrravtefcgnvelcrlte
qvvfsdpyrvstfnrwtspyldddakavredsalkleiaelksmfceraqalihgdlhtg
svmvtqdstqvidpefsfygpmgfdigaylgnlilaffaqdghatqendrkeykqwilrt
ieqtwnlfnkrfialwdqnkdgpgeayladiynntevlkfvqenymrnllhdslgfgaak
mirrivgvahvedfesieedkrraicersalefakmllkerrkfksigevvsaiqqq

Timeline for d2pywa_:

• d2pywa_ first appeared in SCOPe 2.01
  
• d2pywa_ appears in SCOPe 2.05
  
• d2pywa_ appears in SCOPe 2.07
  
• d2pywa_ appears in the current release, SCOPe 2.08