Lineage for d2pysb1 (2pys B:2-103)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2819034Fold b.89: Cyanovirin-N [51321] (1 superfamily)
    complex fold
  4. 2819035Superfamily b.89.1: Cyanovirin-N [51322] (2 families) (S)
    duplication: tandem repeat of two homologous motifs made three stranded beta-sheet and beta-hairpins
    automatically mapped to Pfam PF08881
  5. 2819036Family b.89.1.1: Cyanovirin-N [51323] (2 proteins)
  6. 2819078Protein automated matches [190774] (1 species)
    not a true protein
  7. 2819079Species Nostoc ellipsosporum [TaxId:45916] [188001] (9 PDB entries)
  8. 2819090Domain d2pysb1: 2pys B:2-103 [167348]
    Other proteins in same PDB: d2pysa2, d2pysb2
    automated match to d1iiya_

Details for d2pysb1

PDB Entry: 2pys (more details), 1.8 Å

PDB Description: crystal structure of a five site mutated cyanovirin-n with a mannose dimer bound at 1.8 a resolution
PDB Compounds: (B:) Cyanovirin-N

SCOPe Domain Sequences for d2pysb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pysb1 b.89.1.1 (B:2-103) automated matches {Nostoc ellipsosporum [TaxId: 45916]}
gnfsqacynsaiqgsvltstcirtnggyntssidlnsvienvdgslkwqgsnfietcrnt
qlagsselaaecktraqqfvstkinlddhiaaidgtlkyele

SCOPe Domain Coordinates for d2pysb1:

Click to download the PDB-style file with coordinates for d2pysb1.
(The format of our PDB-style files is described here.)

Timeline for d2pysb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2pysb2