Class b: All beta proteins [48724] (176 folds) |
Fold b.89: Cyanovirin-N [51321] (1 superfamily) complex fold |
Superfamily b.89.1: Cyanovirin-N [51322] (2 families) duplication: tandem repeat of two homologous motifs made three stranded beta-sheet and beta-hairpins automatically mapped to Pfam PF08881 |
Family b.89.1.1: Cyanovirin-N [51323] (2 proteins) |
Protein automated matches [190774] (1 species) not a true protein |
Species Nostoc ellipsosporum [TaxId:45916] [188001] (8 PDB entries) |
Domain d2pysa_: 2pys A: [167347] automated match to d1iiya_ |
PDB Entry: 2pys (more details), 1.8 Å
SCOPe Domain Sequences for d2pysa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pysa_ b.89.1.1 (A:) automated matches {Nostoc ellipsosporum [TaxId: 45916]} gnfsqacynsaiqgsvltstcirtnggyntssidlnsvienvdgslkwqgsnfietcrnt qlagsselaaecktraqqfvstkinlddhiaaidgtlkyel
Timeline for d2pysa_: