Lineage for d2pysa_ (2pys A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1810256Fold b.89: Cyanovirin-N [51321] (1 superfamily)
    complex fold
  4. 1810257Superfamily b.89.1: Cyanovirin-N [51322] (2 families) (S)
    duplication: tandem repeat of two homologous motifs made three stranded beta-sheet and beta-hairpins
    automatically mapped to Pfam PF08881
  5. 1810258Family b.89.1.1: Cyanovirin-N [51323] (2 proteins)
  6. 1810296Protein automated matches [190774] (1 species)
    not a true protein
  7. 1810297Species Nostoc ellipsosporum [TaxId:45916] [188001] (8 PDB entries)
  8. 1810306Domain d2pysa_: 2pys A: [167347]
    automated match to d1iiya_

Details for d2pysa_

PDB Entry: 2pys (more details), 1.8 Å

PDB Description: crystal structure of a five site mutated cyanovirin-n with a mannose dimer bound at 1.8 a resolution
PDB Compounds: (A:) Cyanovirin-N

SCOPe Domain Sequences for d2pysa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pysa_ b.89.1.1 (A:) automated matches {Nostoc ellipsosporum [TaxId: 45916]}
gnfsqacynsaiqgsvltstcirtnggyntssidlnsvienvdgslkwqgsnfietcrnt
qlagsselaaecktraqqfvstkinlddhiaaidgtlkyel

SCOPe Domain Coordinates for d2pysa_:

Click to download the PDB-style file with coordinates for d2pysa_.
(The format of our PDB-style files is described here.)

Timeline for d2pysa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2pysb_