SCOPe 2.02: Domain d2pysa_: 2pys A:

Lineage for d2pysa_ (2pys A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.89: Cyanovirin-N [51321] (1 superfamily)
   complex fold

4. Superfamily b.89.1: Cyanovirin-N [51322] (1 family)
   duplication: tandem repeat of two homologous motifs made three stranded beta-sheet and beta-hairpins

5. Family b.89.1.1: Cyanovirin-N [51323] (2 proteins)

6. Protein automated matches [190774] (1 species)
   not a true protein

7. Species Nostoc ellipsosporum [TaxId:45916] [188001] (5 PDB entries)

8. Domain d2pysa_: 2pys A: [167347]
   automated match to d1iiya_

Details for d2pysa_

PDB Entry: 2pys, 1.8 Å

PDB Description: crystal structure of a five site mutated cyanovirin-n with a mannose dimer bound at 1.8 a resolution

PDB Compounds: (A:) Cyanovirin-N

SCOPe Domain Sequences for d2pysa_:

Sequence; same for both SEQRES and ATOM records:

>d2pysa_ b.89.1.1 (A:) automated matches {Nostoc ellipsosporum [TaxId: 45916]}
gnfsqacynsaiqgsvltstcirtnggyntssidlnsvienvdgslkwqgsnfietcrnt
qlagsselaaecktraqqfvstkinlddhiaaidgtlkyel

Timeline for d2pysa_:

• d2pysa_ first appeared in SCOPe 2.01
  
• d2pysa_ appears in SCOPe 2.03
  
• d2pysa_ appears in the current release, SCOPe 2.08, called d2pysa1