Lineage for d2pynb_ (2pyn B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 955287Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 955288Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 955289Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 955305Protein Human immunodeficiency virus type 1 protease [50632] (5 species)
  7. 955367Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (378 PDB entries)
    Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167
  8. 955664Domain d2pynb_: 2pyn B: [167346]
    automated match to d1odya_
    complexed with 1un; mutant

Details for d2pynb_

PDB Entry: 2pyn (more details), 1.85 Å

PDB Description: hiv-1 pr mutant in complex with nelfinavir
PDB Compounds: (B:) protease retropepsin

SCOPe Domain Sequences for d2pynb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pynb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwqrplvtikiggqlkealldtgadntvleemslpgawkpkmiggiggfikvrqyd
qilieicghkvigtvlvgptpvniigrnlltqigctlnf

SCOPe Domain Coordinates for d2pynb_:

Click to download the PDB-style file with coordinates for d2pynb_.
(The format of our PDB-style files is described here.)

Timeline for d2pynb_: