Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein Dodecameric ferritin homolog [47250] (16 species) |
Species Lyme disease spirochete (Borrelia burgdorferi) [TaxId:139] [188558] (1 PDB entry) |
Domain d2pybd_: 2pyb D: [167341] automated match to d1n1qa_ complexed with fe |
PDB Entry: 2pyb (more details), 2.6 Å
SCOPe Domain Sequences for d2pybd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pybd_ a.25.1.1 (D:) Dodecameric ferritin homolog {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} ddldaiqlklqellaslhifysnlrgihwnikdtnffvihkktqklyeyiekiidivaer srmlgydsefrysefmkksfikeldiestsnflpsmesivcslteilknifgmrklidta gdygtanimddimsdlekhlwmhkallencd
Timeline for d2pybd_: