Lineage for d1qghg_ (1qgh G:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 910725Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 910726Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 910727Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 911056Protein Dodecameric ferritin homolog [47250] (14 species)
  7. 911228Species Listeria innocua [TaxId:1642] [47252] (4 PDB entries)
  8. 911237Domain d1qghg_: 1qgh G: [16734]
    complexed with fe

Details for d1qghg_

PDB Entry: 1qgh (more details), 2.35 Å

PDB Description: the x-ray structure of the unusual dodecameric ferritin from listeria innocua, reveals a novel intersubunit iron binding site.
PDB Compounds: (G:) non-heme iron-containing ferritin

SCOPe Domain Sequences for d1qghg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qghg_ a.25.1.1 (G:) Dodecameric ferritin homolog {Listeria innocua [TaxId: 1642]}
vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
vtndmliafkasidkhiwmfkaflgkaple

SCOPe Domain Coordinates for d1qghg_:

Click to download the PDB-style file with coordinates for d1qghg_.
(The format of our PDB-style files is described here.)

Timeline for d1qghg_: