| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.1: Ferritin [47241] (10 proteins) |
| Protein Dodecameric ferritin homolog [47250] (16 species) |
| Species Lyme disease spirochete (Borrelia burgdorferi) [TaxId:139] [188558] (1 PDB entry) |
| Domain d2pybb_: 2pyb B: [167339] automated match to d1n1qa_ complexed with fe |
PDB Entry: 2pyb (more details), 2.6 Å
SCOPe Domain Sequences for d2pybb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pybb_ a.25.1.1 (B:) Dodecameric ferritin homolog {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}
ddldaiqlklqellaslhifysnlrgihwnikdtnffvihkktqklyeyiekiidivaer
srmlgydsefrysefmkksfikeldiestsnflpsmesivcslteilknifgmrklidta
gdygtanimddimsdlekhlwmhkallencd
Timeline for d2pybb_: