Lineage for d2pyaa_ (2pya A:)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1244855Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1245023Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 1245024Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 1245033Protein Rubredoxin [57804] (8 species)
  7. 1245084Species Pyrococcus abyssi [TaxId:29292] [188135] (3 PDB entries)
  8. 1245086Domain d2pyaa_: 2pya A: [167337]
    automated match to d1bq8a_
    complexed with fe, na

Details for d2pyaa_

PDB Entry: 2pya (more details), 0.86 Å

PDB Description: ultra-high resolution structure of p. abyssi rubredoxin w4l/r5s/a44s
PDB Compounds: (A:) rubredoxin

SCOPe Domain Sequences for d2pyaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pyaa_ g.41.5.1 (A:) Rubredoxin {Pyrococcus abyssi [TaxId: 29292]}
aklsckicgyiydedegdpdngispgtkfedlpddwvcplcgspkseferie

SCOPe Domain Coordinates for d2pyaa_:

Click to download the PDB-style file with coordinates for d2pyaa_.
(The format of our PDB-style files is described here.)

Timeline for d2pyaa_: