![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
![]() | Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
![]() | Protein automated matches [190159] (16 species) not a true protein |
![]() | Species Clupea harengus [TaxId:7950] [187340] (1 PDB entry) |
![]() | Domain d2py2a_: 2py2 A: [167331] automated match to d2afpa_ complexed with ca |
PDB Entry: 2py2 (more details), 1.7 Å
SCOPe Domain Sequences for d2py2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2py2a_ d.169.1.0 (A:) automated matches {Clupea harengus [TaxId: 7950]} cptdwkmfngrcflfnplqlhwadaqescmkeganlasihsleestfvkeltsadlipsw iggtdcqvstrwfwmdstsmdyadwcaaqpdttltecciqmnvgigkcwndtpcthlhss icakplk
Timeline for d2py2a_: