SCOPe 2.05: Domain d2py0a_: 2py0 A:

Lineage for d2py0a_ (2py0 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.24: Pili subunits [54522] (1 superfamily)
   contains very long N-terminal helix, which end is packed against beta-sheet

4. Superfamily d.24.1: Pili subunits [54523] (8 families)
   bacterial filament proteins

5. Family d.24.1.1: Pilin [54524] (5 proteins)

6. Protein Type IV Pilin Pak [109620] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [54527] (3 PDB entries)

8. Domain d2py0a_: 2py0 A: [167330]
   automated match to d1dzoa_
   complexed with epe

Details for d2py0a_

PDB Entry: 2py0, 1.35 Å

PDB Description: crystal structure of cs1 pilin chimera

PDB Compounds: (A:) fimbrial protein

SCOPe Domain Sequences for d2py0a_:

Sequence; same for both SEQRES and ATOM records:

>d2py0a_ d.24.1.1 (A:) Type IV Pilin Pak {Pseudomonas aeruginosa [TaxId: 287]}
egtafarsegasalasvnplkttveealsrgwsvksgtgtedatkkevplgvaadanklg
tialkpdpadgtaditltftmggagpknkgkiitltrtaadglwkcksdqdpqfipkgcs

Timeline for d2py0a_:

• d2py0a_ first appeared in SCOPe 2.01
  
• d2py0a_ appears in SCOPe 2.04
  
• d2py0a_ is called d2py0a1 in SCOPe 2.06
  
• d2py0a_ appears in the current release, SCOPe 2.08, called d2py0a1