SCOPe 2.01: Domain d2pxha_: 2pxh A:

Lineage for d2pxha_ (2pxh A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
   contains a conserved all-alpha subdomain at the C-terminal extension

6. Protein automated matches [190581] (4 species)
   not a true protein

7. Species Methanocaldococcus jannaschii [TaxId:2190] [188187] (5 PDB entries)

8. Domain d2pxha_: 2pxh A: [167329]
   automated match to d1j1ua_
   complexed with bp5

Details for d2pxha_

PDB Entry: 2pxh, 1.97 Å

PDB Description: crystal structure of a bipyridylalanyl-trna synthetase

PDB Compounds: (A:) Tyrosyl-tRNA synthetase

SCOPe Domain Sequences for d2pxha_:

Sequence; same for both SEQRES and ATOM records:

>d2pxha_ c.26.1.1 (A:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
defemikrntseiiseeelrevlkkdeksagigfepsgkihlghylqikkmidlqnagfd
iiiyladlaaylnqkgeldeirkigdynkkvfeamglkakyvygsefqldkdytlnvyrl
alkttlkrarrsmeliaredenpkvaeviypimevngwhysgvdvavggmeqrkihmlar
ellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnpi
meiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikilep
irkrll

Timeline for d2pxha_:

• d2pxha_ is new in SCOPe 2.01-stable
  
• d2pxha_ appears in SCOPe 2.02
  
• d2pxha_ appears in the current release, SCOPe 2.08, called d2pxha1