Lineage for d2pxca_ (2pxc A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1864482Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1864483Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1865109Family c.66.1.25: mRNA cap methylase [88785] (3 proteins)
  6. 1865110Protein An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 [89741] (2 species)
    structurally and functionally similar to VP39
  7. 1865120Species Murray valley encephalitis virus (strain mve-1-51) [TaxId:301478] [187362] (6 PDB entries)
  8. 1865130Domain d2pxca_: 2pxc A: [167328]
    automated match to d1r6aa_
    complexed with g3a, sam

Details for d2pxca_

PDB Entry: 2pxc (more details), 2.8 Å

PDB Description: Crystal structure of the Murray Valley Encephalitis Virus NS5 2'-O Methyltransferase domain in complex with SAM and GTPA
PDB Compounds: (A:) Genome polyprotein [Contains: Capsid protein C (Core protein); Envelope protein M (Matrix protein); Major envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; Flavivirin protease NS3 catalytic subunit; Non-structural protein 4A (NS4A); Non-structural protein 4B (NS4B); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5)]

SCOPe Domain Sequences for d2pxca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pxca_ c.66.1.25 (A:) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Murray valley encephalitis virus (strain mve-1-51) [TaxId: 301478]}
grtlgeqwkeklnamgkeeffsyrkeailevdrtearrarregnkvgghpvsrgtaklrw
lverrfvqpigkvvdlgcgrggwsyyaatmknvqevrgytkggpgheepmlmqsygwniv
tmksgvdvfykpseisdtllcdigesspsaeieeqrtlrilemvsdwlsrgpkefcikil
cpympkviekleslqrrfggglvrvplsrnsnhemywvsgasgnivhavnmtsqvligrm
dkkiwkgpkyeedvnlgsgtrav

SCOPe Domain Coordinates for d2pxca_:

Click to download the PDB-style file with coordinates for d2pxca_.
(The format of our PDB-style files is described here.)

Timeline for d2pxca_: