![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
![]() | Family c.66.1.25: mRNA cap methylase [88785] (4 proteins) |
![]() | Protein An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 [89741] (2 species) structurally and functionally similar to VP39 |
![]() | Species Murray valley encephalitis virus (strain mve-1-51) [TaxId:301478] [187362] (6 PDB entries) |
![]() | Domain d2pxca_: 2pxc A: [167328] automated match to d1r6aa_ complexed with g3a, sam |
PDB Entry: 2pxc (more details), 2.8 Å
SCOPe Domain Sequences for d2pxca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pxca_ c.66.1.25 (A:) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Murray valley encephalitis virus (strain mve-1-51) [TaxId: 301478]} grtlgeqwkeklnamgkeeffsyrkeailevdrtearrarregnkvgghpvsrgtaklrw lverrfvqpigkvvdlgcgrggwsyyaatmknvqevrgytkggpgheepmlmqsygwniv tmksgvdvfykpseisdtllcdigesspsaeieeqrtlrilemvsdwlsrgpkefcikil cpympkviekleslqrrfggglvrvplsrnsnhemywvsgasgnivhavnmtsqvligrm dkkiwkgpkyeedvnlgsgtrav
Timeline for d2pxca_: