Lineage for d1qghe_ (1qgh E:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2448Fold a.25: Ferritin-like [47239] (1 superfamily)
  4. 2449Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
  5. 2450Family a.25.1.1: Ferritin [47241] (4 proteins)
  6. 2525Protein Dodecameric ferritin homolog DPS [47250] (2 species)
  7. 2539Species Listeria innocua [TaxId:1642] [47252] (1 PDB entry)
  8. 2544Domain d1qghe_: 1qgh E: [16732]

Details for d1qghe_

PDB Entry: 1qgh (more details), 2.35 Å

PDB Description: the x-ray structure of the unusual dodecameric ferritin from listeria innocua, reveals a novel intersubunit iron binding site.

SCOP Domain Sequences for d1qghe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qghe_ a.25.1.1 (E:) Dodecameric ferritin homolog DPS {Listeria innocua}
vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
vtndmliafkasidkhiwmfkaflgkaple

SCOP Domain Coordinates for d1qghe_:

Click to download the PDB-style file with coordinates for d1qghe_.
(The format of our PDB-style files is described here.)

Timeline for d1qghe_: