SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2pwpc_ (2pwp C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130608Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2130609Protein automated matches [190689] (63 species)
    not a true protein
  7. 2130825Species Plasmodium falciparum [TaxId:36329] [187826] (16 PDB entries)
  8. 2130841Domain d2pwpc_: 2pwp C: [167316]
    automated match to d1xj5a_
    complexed with gol, so4, spd

Details for d2pwpc_

PDB Entry: 2pwp (more details), 2.1 Å

PDB Description: Crystal structure of spermidine synthase from Plasmodium falciparum in complex with spermidine
PDB Compounds: (C:) spermidine synthase

SCOPe Domain Sequences for d2pwpc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pwpc_ c.66.1.0 (C:) automated matches {Plasmodium falciparum [TaxId: 36329]}
kkwfsefsimwpgqafslkikkilyetkskyqnvlvfesttygkvlvldgviqltekdef
ayhemmthvpmtvskepknvlvvgggdggiirelckyksvenidiceidetvievskiyf
kniscgyedkrvnvfiedaskflenvtntydviivdssdpigpaetlfnqnfyekiynal
kpngycvaqceslwihvgtiknmigyakklfkkveyanisiptypcgcigilccsktdtg
ltkpnkkleskefadlkyynyenhsaafklpafllkeieni

SCOPe Domain Coordinates for d2pwpc_:

Click to download the PDB-style file with coordinates for d2pwpc_.
(The format of our PDB-style files is described here.)

Timeline for d2pwpc_: