| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily) core: 5 helices; bundle |
Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) ![]() |
| Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins) |
| Protein HIV-1 capsid protein [47945] (1 species) |
| Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (70 PDB entries) |
| Domain d2pwod_: 2pwo D: [167313] automated match to d1afva_ complexed with cl |
PDB Entry: 2pwo (more details), 1.45 Å
SCOPe Domain Sequences for d2pwod_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pwod_ a.73.1.1 (D:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmy
Timeline for d2pwod_: