Lineage for d2pwob_ (2pwo B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717816Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2717817Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2717818Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 2717857Protein HIV-1 capsid protein [47945] (1 species)
  7. 2717858Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (70 PDB entries)
  8. 2717872Domain d2pwob_: 2pwo B: [167311]
    automated match to d1afva_
    complexed with cl

Details for d2pwob_

PDB Entry: 2pwo (more details), 1.45 Å

PDB Description: crystal structure of hiv-1 ca146 a92e psuedo cell
PDB Compounds: (B:) Gag-Pol polyprotein (Pr160Gag-Pol)

SCOPe Domain Sequences for d2pwob_:

Sequence, based on SEQRES records: (download)

>d2pwob_ a.73.1.1 (B:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmy

Sequence, based on observed residues (ATOM records): (download)

>d2pwob_ a.73.1.1 (B:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiepmreprgsdiagttstlqeqigwmthnp
pipvgeiykrwiilglnkivrmy

SCOPe Domain Coordinates for d2pwob_:

Click to download the PDB-style file with coordinates for d2pwob_.
(The format of our PDB-style files is described here.)

Timeline for d2pwob_: