Lineage for d2pwoa_ (2pwo A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1273716Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 1273717Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 1273718Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 1273757Protein HIV-1 capsid protein [47945] (1 species)
  7. 1273758Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (25 PDB entries)
  8. 1273759Domain d2pwoa_: 2pwo A: [167310]
    automated match to d1afva_
    complexed with cl

Details for d2pwoa_

PDB Entry: 2pwo (more details), 1.45 Å

PDB Description: crystal structure of hiv-1 ca146 a92e psuedo cell
PDB Compounds: (A:) Gag-Pol polyprotein (Pr160Gag-Pol)

SCOPe Domain Sequences for d2pwoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pwoa_ a.73.1.1 (A:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
ivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgg
hqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmthn
ppipvgeiykrwiilglnkivrmy

SCOPe Domain Coordinates for d2pwoa_:

Click to download the PDB-style file with coordinates for d2pwoa_.
(The format of our PDB-style files is described here.)

Timeline for d2pwoa_: