Lineage for d1qghd_ (1qgh D:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 441060Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 441061Superfamily a.25.1: Ferritin-like [47240] (3 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 441062Family a.25.1.1: Ferritin [47241] (7 proteins)
  6. 441196Protein Dodecameric ferritin homolog [47250] (10 species)
  7. 441334Species Listeria innocua [TaxId:1642] [47252] (1 PDB entry)
  8. 441338Domain d1qghd_: 1qgh D: [16731]

Details for d1qghd_

PDB Entry: 1qgh (more details), 2.35 Å

PDB Description: the x-ray structure of the unusual dodecameric ferritin from listeria innocua, reveals a novel intersubunit iron binding site.

SCOP Domain Sequences for d1qghd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qghd_ a.25.1.1 (D:) Dodecameric ferritin homolog {Listeria innocua}
vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
vtndmliafkasidkhiwmfkaflgkaple

SCOP Domain Coordinates for d1qghd_:

Click to download the PDB-style file with coordinates for d1qghd_.
(The format of our PDB-style files is described here.)

Timeline for d1qghd_: