SCOP 1.59: Domain d1qghd_: 1qgh D:

Lineage for d1qghd_ (1qgh D:)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.25: Ferritin-like [47239] (1 superfamily)

4. Superfamily a.25.1: Ferritin-like [47240] (2 families)

5. Family a.25.1.1: Ferritin [47241] (5 proteins)

6. Protein Dodecameric ferritin homolog DPS [47250] (2 species)

7. Species Listeria innocua [TaxId:1642] [47252] (1 PDB entry)

8. Domain d1qghd_: 1qgh D: [16731]

Details for d1qghd_

PDB Entry: 1qgh, 2.35 Å

PDB Description: the x-ray structure of the unusual dodecameric ferritin from listeria innocua, reveals a novel intersubunit iron binding site.

SCOP Domain Sequences for d1qghd_:

Sequence; same for both SEQRES and ATOM records:

>d1qghd_ a.25.1.1 (D:) Dodecameric ferritin homolog DPS {Listeria innocua}
vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
vtndmliafkasidkhiwmfkaflgkaple

Timeline for d1qghd_:

• d1qghd_ first appeared (with stable ids) in SCOP 1.55
  
• d1qghd_ appears in SCOP 1.57
  
• d1qghd_ appears in SCOP 1.61
  
• d1qghd_ appears in the current release, SCOPe 2.08