![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily) core: 5 helices; bundle |
![]() | Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) ![]() |
![]() | Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins) |
![]() | Protein HIV-1 capsid protein [47945] (1 species) |
![]() | Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (70 PDB entries) |
![]() | Domain d2pwmf_: 2pwm F: [167307] automated match to d1afva_ complexed with cl |
PDB Entry: 2pwm (more details), 1.9 Å
SCOPe Domain Sequences for d2pwmf_:
Sequence, based on SEQRES records: (download)
>d2pwmf_ a.73.1.1 (F:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]} pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth nppipvgeiykrwiilglnkivrmy
>d2pwmf_ a.73.1.1 (F:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]} pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg ghqaamqmlketineeaaewdrlhpvhmreprgsdiagttstlqeqigwmthnppipvge iykrwiilglnkivrmy
Timeline for d2pwmf_: