Class a: All alpha proteins [46456] (286 folds) |
Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily) core: 5 helices; bundle |
Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) |
Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins) |
Protein HIV-1 capsid protein [47945] (1 species) |
Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (37 PDB entries) |
Domain d2pwmb_: 2pwm B: [167303] automated match to d1afva_ complexed with cl |
PDB Entry: 2pwm (more details), 1.9 Å
SCOPe Domain Sequences for d2pwmb_:
Sequence, based on SEQRES records: (download)
>d2pwmb_ a.73.1.1 (B:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]} pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth nppipvgeiykrwiilglnkivrmy
>d2pwmb_ a.73.1.1 (B:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]} pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg ghqaamqmlketineeaaewdrlhpvhmreprgsdiagttstlqeqigwmthnppipvge iykrwiilglnkivrmy
Timeline for d2pwmb_: