SCOPe 2.03: Domain d2pwma_: 2pwm A:

Lineage for d2pwma_ (2pwm A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families)

5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)

6. Protein HIV-1 capsid protein [47945] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (25 PDB entries)

8. Domain d2pwma_: 2pwm A: [167302]
   automated match to d1afva_
   complexed with cl

Details for d2pwma_

PDB Entry: 2pwm, 1.9 Å

PDB Description: crystal structure of hiv-1 ca146 a92e real cell

PDB Compounds: (A:) Gag-Pol polyprotein

SCOPe Domain Sequences for d2pwma_:

Sequence; same for both SEQRES and ATOM records:

>d2pwma_ a.73.1.1 (A:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmy

Timeline for d2pwma_:

• d2pwma_ first appeared in SCOPe 2.01
  
• d2pwma_ appears in SCOPe 2.02
  
• d2pwma_ appears in SCOPe 2.04
  
• d2pwma_ appears in the current release, SCOPe 2.08