SCOPe 2.07: Domain d2pw3a_: 2pw3 A:

Lineage for d2pw3a_ (2pw3 A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.2: PDEase [48548] (7 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89152] (72 PDB entries)
   Uniprot Q08499 388-713

8. Domain d2pw3a_: 2pw3 A: [167297]
   automated match to d1mkda_
   complexed with cmp, zn

Details for d2pw3a_

PDB Entry: 2pw3, 1.56 Å

PDB Description: structure of the pde4d-camp complex

PDB Compounds: (A:) cAMP-specific 3',5'-cyclic phosphodiesterase 4D

SCOPe Domain Sequences for d2pw3a_:

Sequence; same for both SEQRES and ATOM records:

>d2pw3a_ a.211.1.2 (A:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
teqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlity
lmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihnvdhp
gvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvi
divlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkp
lqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwa
dlvhpdaqdildtlednrewyqstipq

Timeline for d2pw3a_:

• d2pw3a_ first appeared in SCOPe 2.01
  
• d2pw3a_ appears in SCOPe 2.06
  
• d2pw3a_ appears in the current release, SCOPe 2.08