Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d2pvxh_ (2pvx H:)

  1. Root: SCOP 1.75B
  2. Class g: Small proteins [56992] (90 folds)
  3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. Family g.41.5.1: Rubredoxin [57803] (5 protein domains)
  6. Protein Rubredoxin [57804] (8 species)
  7. Species Pyrococcus furiosus [TaxId:2261] [57809] (24 PDB entries)
    Uniprot P24297
  8. Domain d2pvxh_: 2pvx H: [167296]
    automated match to d1bq8a_
    complexed with zn

Details for d2pvxh_

PDB Entry: 2pvx (more details)
PDB Description: nmr and x-ray analysis of structural additivity in metal binding site-swapped hybrids of rubredoxin
PDB Compounds: (H:) rubredoxin

SCOP Domain Sequences for d2pvxh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pvxh_ g.41.5.1 (H:) Rubredoxin {Pyrococcus furiosus [TaxId: 2261]}
mkkwvctvcgyiydedagdpdngispgtkfeelpddwvcplcgvgkdqfekled

SCOP Domain Coordinates for d2pvxh_:

Click to download the PDB-style file with coordinates for d2pvxh_.
(The format of our PDB-style files is described here.)

Timeline for d2pvxh_:

d2pvxh_ appears in SCOP 1.75A


d2pvxh_
(click for larger image)


d2pvxh_ in context of chain



d2pvxh_ in context of PDB
Domains from other chains:
d2pvxa_, d2pvxb_, d2pvxc_, d2pvxd_, d2pvxe_, d2pvxf_, d2pvxg_


SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu