| Class g: Small proteins [56992] (90 folds) |
| Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.5: Rubredoxin-like [57802] (3 families) ![]() |
| Family g.41.5.1: Rubredoxin [57803] (5 protein domains) |
| Protein Rubredoxin [57804] (8 species) |
| Species Pyrococcus furiosus [TaxId:2261] [57809] (24 PDB entries) Uniprot P24297 |
| Domain d2pvxd_: 2pvx D: [167292] automated match to d1bq8a_ complexed with zn |
| PDB Entry: 2pvx (more details) PDB Description: nmr and x-ray analysis of structural additivity in metal binding site-swapped hybrids of rubredoxin
PDB Compounds: (D:) rubredoxinSCOP Domain Sequences for d2pvxd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pvxd_ g.41.5.1 (D:) Rubredoxin {Pyrococcus furiosus [TaxId: 2261]}
mkkwvctvcgyiydedagdpdngispgtkfeelpddwvcplcgvgkdqfekled
SCOP Domain Coordinates for d2pvxd_:
Click to download the PDB-style file with coordinates for d2pvxd_. (The format of our PDB-style files is described here.)
Timeline for d2pvxd_:
d2pvxd_ appears in SCOP 1.75A | d2pvxd_ (click for larger image) d2pvxd_ in context of chain d2pvxd_ in context of PDB Domains from other chains: d2pvxa_, d2pvxb_, d2pvxc_, d2pvxe_, d2pvxf_, d2pvxg_, d2pvxh_ |
|
|
Copyright © 1994-2013 The SCOP
and Astral authors scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu |