Lineage for d2pvxc_ (2pvx C:)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1464002Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1464186Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 1464187Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 1464196Protein Rubredoxin [57804] (8 species)
  7. 1464256Species Pyrococcus furiosus [TaxId:2261] [57809] (25 PDB entries)
    Uniprot P24297
  8. 1464262Domain d2pvxc_: 2pvx C: [167291]
    automated match to d1bq8a_
    complexed with zn

Details for d2pvxc_

PDB Entry: 2pvx (more details), 1.04 Å

PDB Description: nmr and x-ray analysis of structural additivity in metal binding site- swapped hybrids of rubredoxin
PDB Compounds: (C:) rubredoxin

SCOPe Domain Sequences for d2pvxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pvxc_ g.41.5.1 (C:) Rubredoxin {Pyrococcus furiosus [TaxId: 2261]}
mkkwvctvcgyiydedagdpdngispgtkfeelpddwvcplcgvgkdqfekled

SCOPe Domain Coordinates for d2pvxc_:

Click to download the PDB-style file with coordinates for d2pvxc_.
(The format of our PDB-style files is described here.)

Timeline for d2pvxc_: