![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.5: Rubredoxin-like [57802] (4 families) ![]() |
![]() | Family g.41.5.1: Rubredoxin [57803] (5 proteins) |
![]() | Protein Rubredoxin [57804] (8 species) |
![]() | Species Pyrococcus furiosus [TaxId:2261] [57809] (30 PDB entries) Uniprot P24297 |
![]() | Domain d2pvxb_: 2pvx B: [167290] automated match to d1bq8a_ complexed with zn |
PDB Entry: 2pvx (more details), 1.04 Å
SCOPe Domain Sequences for d2pvxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pvxb_ g.41.5.1 (B:) Rubredoxin {Pyrococcus furiosus [TaxId: 2261]} mkkwvctvcgyiydedagdpdngispgtkfeelpddwvcplcgvgkdqfekled
Timeline for d2pvxb_: