Domain d2pvxa_: 2pvx A:

Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)

Lineage for d2pvxa_ (2pvx A:)

Root: SCOP 1.75B
Class g: Small proteins [56992] (90 folds)
Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
Superfamily g.41.5: Rubredoxin-like [57802] (3 families)
Family g.41.5.1: Rubredoxin [57803] (5 protein domains)
Protein Rubredoxin [57804] (8 species)
Species Pyrococcus furiosus [TaxId:2261] [57809] (24 PDB entries)
Uniprot P24297
Domain d2pvxa_: 2pvx A: [167289]
automated match to d1bq8a_
complexed with zn

PDB Entry: 2pvx (more details)
PDB Description: nmr and x-ray analysis of structural additivity in metal binding site-swapped hybrids of rubredoxin
PDB Compounds: (A:) rubredoxin

SCOP Domain Sequences for d2pvxa_:
Sequence; same for both SEQRES and ATOM records: (download)

>d2pvxa_ g.41.5.1 (A:) Rubredoxin {Pyrococcus furiosus [TaxId: 2261]} mkkwvctvcgyiydedagdpdngispgtkfeelpddwvcplcgvgkdqfekle

SCOP Domain Coordinates for d2pvxa_:

Click to download the PDB-style file with coordinates for d2pvxa_.
(The format of our PDB-style files is described here.)

Timeline for d2pvxa_:
d2pvxa_ appears in SCOP 1.75A

d2pvxa_
(click for larger image)

d2pvxa_ in context of chain

d2pvxa_ in context of PDB
Domains from other chains:
d2pvxb_, d2pvxc_, d2pvxd_, d2pvxe_, d2pvxf_, d2pvxg_, d2pvxh_