Class g: Small proteins [56992] (94 folds) |
Fold g.36: Ferredoxin thioredoxin reductase (FTR), catalytic beta chain [57661] (1 superfamily) folds around 4Fe-4S cluster |
Superfamily g.36.1: Ferredoxin thioredoxin reductase (FTR), catalytic beta chain [57662] (1 family) automatically mapped to Pfam PF02943 |
Family g.36.1.1: Ferredoxin thioredoxin reductase (FTR), catalytic beta chain [57663] (1 protein) |
Protein Ferredoxin thioredoxin reductase (FTR), catalytic beta chain [57664] (1 species) |
Species Synechocystis sp. [TaxId:1143] [57665] (7 PDB entries) |
Domain d2pvga1: 2pvg A:10-115 [167285] Other proteins in same PDB: d2pvga2, d2pvgb_, d2pvgc_ automated match to d1dj7a_ complexed with fes, sf4 |
PDB Entry: 2pvg (more details), 2.4 Å
SCOPe Domain Sequences for d2pvga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pvga1 g.36.1.1 (A:10-115) Ferredoxin thioredoxin reductase (FTR), catalytic beta chain {Synechocystis sp. [TaxId: 1143]} tlaamknfaeqyakrtdtyfcsdlsvtavvieglarhkeelgsplcpcrhyedkeaevkn tfwncpcvpmrerkechcmlfltpdndfagdaqdipmetleekkas
Timeline for d2pvga1: