Lineage for d2pveb_ (2pve B:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1065992Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1066160Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 1066161Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 1066278Protein automated matches [190785] (2 species)
    not a true protein
  7. 1066279Species Clostridium pasteurianum [TaxId:1501] [188301] (1 PDB entry)
  8. 1066281Domain d2pveb_: 2pve B: [167283]
    automated match to d1t9pa_
    complexed with act, edo, zn

Details for d2pveb_

PDB Entry: 2pve (more details), 0.79 Å

PDB Description: nmr and x-ray analysis of structural additivity in metal binding site- swapped hybrids of rubredoxin
PDB Compounds: (B:) rubredoxin

SCOPe Domain Sequences for d2pveb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pveb_ g.41.5.1 (B:) automated matches {Clostridium pasteurianum [TaxId: 1501]}
mkkytckicgyiynpedgdpdngvnpgtdfkdipddwvcpicgapksefeev

SCOPe Domain Coordinates for d2pveb_:

Click to download the PDB-style file with coordinates for d2pveb_.
(The format of our PDB-style files is described here.)

Timeline for d2pveb_: