SCOPe 2.01: Domain d2pvdb_: 2pvd B:

Lineage for d2pvdb_ (2pvd B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families)

5. Family b.34.4.3: Ferredoxin thioredoxin reductase (FTR), alpha (variable) chain [50098] (1 protein)

6. Protein Ferredoxin thioredoxin reductase (FTR), alpha (variable) chain [50099] (1 species)

7. Species Synechocystis sp. [TaxId:1143] [50100] (7 PDB entries)

8. Domain d2pvdb_: 2pvd B: [167281]
   Other proteins in same PDB: d2pvda_
   automated match to d1dj7b_
   complexed with sf4, so4

Details for d2pvdb_

PDB Entry: 2pvd, 1.95 Å

PDB Description: crystal srtucture of the reduced ferredoxin:thioredoxin reductase

PDB Compounds: (B:) Ferredoxin-thioredoxin reductase, variable chain

SCOPe Domain Sequences for d2pvdb_:

Sequence; same for both SEQRES and ATOM records:

>d2pvdb_ b.34.4.3 (B:) Ferredoxin thioredoxin reductase (FTR), alpha (variable) chain {Synechocystis sp. [TaxId: 1143]}
mnvgdrvrvtssvvvyhhpehaktafdlqgmegevaavltgwqgrpisanlpvlvkfeqr
fkahfrpdevtli

Timeline for d2pvdb_:

• d2pvdb_ is new in SCOPe 2.01-stable
  
• d2pvdb_ appears in SCOPe 2.02
  
• d2pvdb_ appears in the current release, SCOPe 2.08