![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.36: Ferredoxin thioredoxin reductase (FTR), catalytic beta chain [57661] (1 superfamily) folds around 4Fe-4S cluster |
![]() | Superfamily g.36.1: Ferredoxin thioredoxin reductase (FTR), catalytic beta chain [57662] (1 family) ![]() automatically mapped to Pfam PF02943 |
![]() | Family g.36.1.1: Ferredoxin thioredoxin reductase (FTR), catalytic beta chain [57663] (1 protein) |
![]() | Protein Ferredoxin thioredoxin reductase (FTR), catalytic beta chain [57664] (2 species) |
![]() | Species Synechocystis sp. [TaxId:1143] [57665] (7 PDB entries) |
![]() | Domain d2pvda_: 2pvd A: [167280] Other proteins in same PDB: d2pvdb_ automated match to d1dj7a_ complexed with sf4, so4 |
PDB Entry: 2pvd (more details), 1.95 Å
SCOPe Domain Sequences for d2pvda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pvda_ g.36.1.1 (A:) Ferredoxin thioredoxin reductase (FTR), catalytic beta chain {Synechocystis sp. [TaxId: 1143]} laamknfaeqyakrtdtyfcsdlsvtavvieglarhkeelgsplcpcrhyadkeaevknt fwncpcvpmrerkechcmlfltpdndfagdaqgipmetleekkasma
Timeline for d2pvda_: