SCOPe 2.08: Domain d2pvda_: 2pvd A:

Lineage for d2pvda_ (2pvd A:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.36: Ferredoxin thioredoxin reductase (FTR), catalytic beta chain [57661] (1 superfamily)
   folds around 4Fe-4S cluster

4. Superfamily g.36.1: Ferredoxin thioredoxin reductase (FTR), catalytic beta chain [57662] (1 family)
   automatically mapped to Pfam PF02943

5. Family g.36.1.1: Ferredoxin thioredoxin reductase (FTR), catalytic beta chain [57663] (1 protein)

6. Protein Ferredoxin thioredoxin reductase (FTR), catalytic beta chain [57664] (2 species)

7. Species Synechocystis sp. [TaxId:1143] [57665] (7 PDB entries)

8. Domain d2pvda_: 2pvd A: [167280]
   Other proteins in same PDB: d2pvdb_
   automated match to d1dj7a_
   complexed with sf4, so4

Details for d2pvda_

PDB Entry: 2pvd, 1.95 Å

PDB Description: crystal srtucture of the reduced ferredoxin:thioredoxin reductase

PDB Compounds: (A:) Ferredoxin-thioredoxin reductase, catalytic chain

SCOPe Domain Sequences for d2pvda_:

Sequence; same for both SEQRES and ATOM records:

>d2pvda_ g.36.1.1 (A:) Ferredoxin thioredoxin reductase (FTR), catalytic beta chain {Synechocystis sp. [TaxId: 1143]}
laamknfaeqyakrtdtyfcsdlsvtavvieglarhkeelgsplcpcrhyadkeaevknt
fwncpcvpmrerkechcmlfltpdndfagdaqgipmetleekkasma

Timeline for d2pvda_:

• d2pvda_ first appeared in SCOPe 2.01
  
• d2pvda_ appears in SCOPe 2.07