Lineage for d2puua_ (2puu A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2544248Protein MAP kinase p38 [56129] (2 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. 2544452Species Mouse (Mus musculus) [TaxId:10090] [56131] (35 PDB entries)
  8. 2544469Domain d2puua_: 2puu A: [167277]
    automated match to d1a9ua_
    complexed with g2g

Details for d2puua_

PDB Entry: 2puu (more details), 2.5 Å

PDB Description: crystal structure of p38 complex with 1-(5-tert-butyl-2-p-tolyl-2h- pyrazol-3-yl)-3-[4-(6-morpholin-4-ylmethyl-pyridin-3-yl)naphthalen-1- yl]urea
PDB Compounds: (A:) Mitogen-activated protein kinase 14

SCOPe Domain Sequences for d2puua_:

Sequence, based on SEQRES records: (download)

>d2puua_ d.144.1.7 (A:) MAP kinase p38 {Mouse (Mus musculus) [TaxId: 10090]}
rptfyrqelaktiwevperyqnlspvgsgaygsvcaafdtktghrvavkklsrpfqsiih
akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcakltd
dhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyva
trwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpga
ellkkissesarnyiqslaqmpkmnfanvfiganplavdllekmlvldsdkritaaqala
hayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvppp

Sequence, based on observed residues (ATOM records): (download)

>d2puua_ d.144.1.7 (A:) MAP kinase p38 {Mouse (Mus musculus) [TaxId: 10090]}
rptfyrqelaktiwevperyqnlspvsvcaafdtktghrvavkklsrpfqsiihakrtyr
elrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcakltddhvqfl
iyqilrglkyihsadiihrdlkpsnlavnedcelkildfgvatrwyrapeimlnwmhynq
tvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarnyiqsl
aqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddepvadp
ydqsfesrdllidewksltydevisfvppp

SCOPe Domain Coordinates for d2puua_:

Click to download the PDB-style file with coordinates for d2puua_.
(The format of our PDB-style files is described here.)

Timeline for d2puua_: