SCOPe 2.05: Domain d2purb_: 2pur B:

Lineage for d2purb_ (2pur B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein Dihydrodipicolinate synthase [51574] (12 species)

7. Species Escherichia coli [TaxId:562] [51575] (15 PDB entries)

8. Domain d2purb_: 2pur B: [167276]
   automated match to d1dhpa_
   complexed with gol, k, po4; mutant

Details for d2purb_

PDB Entry: 2pur, 1.7 Å

PDB Description: structure of dihydrodipicolinate synthase mutant thr44ser at 1.7 a.

PDB Compounds: (B:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d2purb_:

Sequence; same for both SEQRES and ATOM records:

>d2purb_ c.1.10.1 (B:) Dihydrodipicolinate synthase {Escherichia coli [TaxId: 562]}
mftgsivaivtpmdekgnvcraslkklidyhvasgtsaivsvgstgesatlnhdehadvv
mmtldladgripviagtganataeaisltqrfndsgivgcltvtpyynrpsqeglyqhfk
aiaehtdlpqilynvpsrtgcdllpetvgrlakvkniigikeatgnltrvnqikelvsdd
fvllsgddasaldfmqlgghgvisvtanvaardmaqmcklaaeghfaearvinqrlmplh
nklfvepnpipvkwackelglvatdtlrlpmtpitdsgretvraalkhagll

Timeline for d2purb_:

• d2purb_ first appeared in SCOPe 2.01
  
• d2purb_ appears in SCOPe 2.04
  
• d2purb_ appears in SCOPe 2.06
  
• d2purb_ appears in the current release, SCOPe 2.08