Lineage for d2pu7a_ (2pu7 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2900404Family c.69.1.10: Carbon-carbon bond hydrolase [53522] (3 proteins)
    closely related to the Proline iminopeptidase-like family
  6. 2900405Protein 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) [53523] (2 species)
  7. 2900406Species Burkholderia xenovorans [TaxId:36873] [159736] (13 PDB entries)
    Uniprot P47229 4-286
  8. 2900417Domain d2pu7a_: 2pu7 A: [167273]
    automated match to d2puha1
    complexed with mli, na; mutant

Details for d2pu7a_

PDB Entry: 2pu7 (more details), 2.07 Å

PDB Description: crystal structure of s112a/h265a double mutant of a c-c hydrolase, bphd, from burkholderia xenovorans lb400
PDB Compounds: (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase

SCOPe Domain Sequences for d2pu7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pu7a_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]}
ltesstskfvkinekgfsdfnihyneagngetvimlhgggpgaggwsnyyrnvgpfvdag
yrvilkdspgfnksdavvmdeqrglvnaravkglmdaldidrahlvgnamggatalnfal
eypdrigklilmgpgglgpsmfapmpmegikllfklyaepsyetlkqmlqvflydqslit
eellqgrweaiqrqpehlknflisaqkaplstwdvtarlgeikaktfitwgrddrfvpld
hglkllwniddarlhvfskcgawaqwehadefnrlvidflrha

SCOPe Domain Coordinates for d2pu7a_:

Click to download the PDB-style file with coordinates for d2pu7a_.
(The format of our PDB-style files is described here.)

Timeline for d2pu7a_: