Lineage for d2pt1a_ (2pt1 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2163419Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2163420Protein automated matches [190039] (140 species)
    not a true protein
  7. 2164310Species Synechocystis sp. PCC 6803 [TaxId:1148] [187344] (3 PDB entries)
  8. 2164313Domain d2pt1a_: 2pt1 A: [167265]
    automated match to d1y4ta_
    complexed with so4

Details for d2pt1a_

PDB Entry: 2pt1 (more details), 2 Å

PDB Description: FutA1 Synechocystis PCC 6803
PDB Compounds: (A:) Iron transport protein

SCOPe Domain Sequences for d2pt1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pt1a_ c.94.1.0 (A:) automated matches {Synechocystis sp. PCC 6803 [TaxId: 1148]}
qqeinlyssrhyntdnelyakftaetgikvnliegkadellerikseganspadvlltvd
larlwraeedgifqpvqseiletnvpeylrspdgmwfgftkrarvimynkgkvkpeelst
yeeladpkwkgrviirsssneynqslvaslvvadgeestlawakgfvsnfarepqgndta
qieavssgeadltlantyymgrllesedpaqkaiaenvgvffpnqegrgthvnvsgvgvv
ktapnregavkfieflvsepaqaflaqnnyeypvlagvplnksvasfgefksdttsldkl
gpalapatkimneagwk

SCOPe Domain Coordinates for d2pt1a_:

Click to download the PDB-style file with coordinates for d2pt1a_.
(The format of our PDB-style files is described here.)

Timeline for d2pt1a_: