Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (20 species) not a true protein |
Species Synechocystis sp. PCC 6803 [TaxId:1148] [187344] (3 PDB entries) |
Domain d2pt1a_: 2pt1 A: [167265] automated match to d1y4ta_ complexed with so4 |
PDB Entry: 2pt1 (more details), 2 Å
SCOPe Domain Sequences for d2pt1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pt1a_ c.94.1.0 (A:) automated matches {Synechocystis sp. PCC 6803 [TaxId: 1148]} qqeinlyssrhyntdnelyakftaetgikvnliegkadellerikseganspadvlltvd larlwraeedgifqpvqseiletnvpeylrspdgmwfgftkrarvimynkgkvkpeelst yeeladpkwkgrviirsssneynqslvaslvvadgeestlawakgfvsnfarepqgndta qieavssgeadltlantyymgrllesedpaqkaiaenvgvffpnqegrgthvnvsgvgvv ktapnregavkfieflvsepaqaflaqnnyeypvlagvplnksvasfgefksdttsldkl gpalapatkimneagwk
Timeline for d2pt1a_: