SCOPe 2.01: Domain d2ps1b_: 2ps1 B:

Lineage for d2ps1b_ (2ps1 B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (5 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188318] (3 PDB entries)

8. Domain d2ps1b_: 2ps1 B: [167258]
   automated match to d1lh0a_
   complexed with mg, oro, prp

Details for d2ps1b_

PDB Entry: 2ps1, 1.75 Å

PDB Description: s. cerevisiae orotate phosphoribosyltransferase complexed with orotic acid and prpp

PDB Compounds: (B:) Orotate phosphoribosyltransferase 1

SCOPe Domain Sequences for d2ps1b_:

Sequence; same for both SEQRES and ATOM records:

>d2ps1b_ c.61.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
imledyqknflelaiecqalrfgsfklksgrespyffnlglfntgkllsnlatayaiaii
qsdlkfdvifgpaykgiplaaivcvklaeiggskfqniqyafnrkeakdhgeggiivgsa
lenkriliiddvmtagtaineafeiisnakgqvvgsiialdrqevvstddkeglsatqtv
skkygipvlsivslihiitylegritaeekskieqylqtygasa

Timeline for d2ps1b_:

• d2ps1b_ is new in SCOPe 2.01-stable
  
• d2ps1b_ appears in SCOPe 2.02
  
• d2ps1b_ appears in the current release, SCOPe 2.08