Lineage for d2ps1b_ (2ps1 B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 998754Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 998755Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 999128Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 999129Protein automated matches [190891] (5 species)
    not a true protein
  7. 999140Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188318] (3 PDB entries)
  8. 999142Domain d2ps1b_: 2ps1 B: [167258]
    automated match to d1lh0a_
    complexed with mg, oro, prp

Details for d2ps1b_

PDB Entry: 2ps1 (more details), 1.75 Å

PDB Description: s. cerevisiae orotate phosphoribosyltransferase complexed with orotic acid and prpp
PDB Compounds: (B:) Orotate phosphoribosyltransferase 1

SCOPe Domain Sequences for d2ps1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ps1b_ c.61.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
imledyqknflelaiecqalrfgsfklksgrespyffnlglfntgkllsnlatayaiaii
qsdlkfdvifgpaykgiplaaivcvklaeiggskfqniqyafnrkeakdhgeggiivgsa
lenkriliiddvmtagtaineafeiisnakgqvvgsiialdrqevvstddkeglsatqtv
skkygipvlsivslihiitylegritaeekskieqylqtygasa

SCOPe Domain Coordinates for d2ps1b_:

Click to download the PDB-style file with coordinates for d2ps1b_.
(The format of our PDB-style files is described here.)

Timeline for d2ps1b_: