Lineage for d2przb_ (2prz B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891861Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 2891862Protein automated matches [190891] (38 species)
    not a true protein
  7. 2891906Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188318] (4 PDB entries)
  8. 2891911Domain d2przb_: 2prz B: [167254]
    automated match to d1lh0a_
    complexed with cl, omp

Details for d2przb_

PDB Entry: 2prz (more details), 1.9 Å

PDB Description: s. cerevisiae orotate phosphoribosyltransferase complexed with omp
PDB Compounds: (B:) Orotate phosphoribosyltransferase 1

SCOPe Domain Sequences for d2przb_:

Sequence, based on SEQRES records: (download)

>d2przb_ c.61.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
imledyqknflelaiecqalrfgsfklksgrespyffnlglfntgkllsnlatayaiaii
qsdlkfdvifgpaykgiplaaivcvklaeiggskfqniqyafnrkeakdhgeggiivgsa
lenkriliiddvmtagtaineafeiisnakgqvvgsiialdrqevvstddkeglsatqtv
skkygipvlsivslihiitylegritaeekskieqylqtygas

Sequence, based on observed residues (ATOM records): (download)

>d2przb_ c.61.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
imledyqknflelaiecqalrfgsfklksgrespyffnlglfntgkllsnlatayaiaii
qsdlkfdvifgpaykgiplaaivcvklaeiggskfqniqyafnrkeaiivgsalenkril
iiddvmtagtaineafeiisnakgqvvgsiialdrqevvstddkeglsatqtvskkygip
vlsivslihiitylegritaeekskieqylqtygas

SCOPe Domain Coordinates for d2przb_:

Click to download the PDB-style file with coordinates for d2przb_.
(The format of our PDB-style files is described here.)

Timeline for d2przb_: