| Class b: All beta proteins [48724] (180 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
| Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
| Protein automated matches [190770] (51 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [187995] (2 PDB entries) |
| Domain d2pqsc1: 2pqs C:1-158 [167248] Other proteins in same PDB: d2pqsa2, d2pqsb2, d2pqsc2, d2pqsd2 automated match to d1czsa_ |
PDB Entry: 2pqs (more details), 2.4 Å
SCOPe Domain Sequences for d2pqsc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pqsc1 b.18.1.0 (C:1-158) automated matches {Cow (Bos taurus) [TaxId: 9913]}
cteplglkdntipnkqitassyyktwglsafswfpyyarldnqgkfnawtaqtnsasewl
qidlgsqkrvtgiitqgardfghiqyvaayrvaygddgvtwteykdpgaseskifpgnmd
nnshkknifetpfqarfvriqpvawhnritlrvellgc
Timeline for d2pqsc1: